PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Aqcoe5G012100.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; stem eudicotyledons; Ranunculales; Ranunculaceae; Thalictroideae; Aquilegia
Family MYB
Protein Properties Length: 239aa    MW: 27546.8 Da    PI: 9.441
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Aqcoe5G012100.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding59.29.1e-191663148
                       TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
    Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                       +g+WT+eEd++l+++v+++G g+W+++a   g++R +k+c++rw +yl
  Aqcoe5G012100.1.p 16 KGPWTAEEDKKLIEYVNLHGEGRWNSVAMFSGLKRNGKSCRLRWVNYL 63
                       79******************************9*************97 PP

2Myb_DNA-binding52.11.5e-1669113147
                        TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
    Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                        rg+ T+ E+ +++++++++G++ W+tIar ++ gRt++++k++w+++
  Aqcoe5G012100.1.p  69 RGKITPNEENIILELHARWGNR-WSTIARSLP-GRTDNEIKNYWRTH 113
                        8999******************.*********.************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129417.2091163IPR017930Myb domain
SuperFamilySSF466891.61E-3013110IPR009057Homeodomain-like
SMARTSM007171.4E-161565IPR001005SANT/Myb domain
PfamPF002493.3E-171663IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.603.0E-241770IPR009057Homeodomain-like
CDDcd001673.70E-121863No hitNo description
PROSITE profilePS5129424.68264118IPR017930Myb domain
SMARTSM007171.4E-1468116IPR001005SANT/Myb domain
PfamPF002491.6E-1469113IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.3E-2471117IPR009057Homeodomain-like
CDDcd001678.26E-1073114No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 239 aa     Download sequence    Send to blast
MAGYLGWGIL EEGWRKGPWT AEEDKKLIEY VNLHGEGRWN SVAMFSGLKR NGKSCRLRWV  60
NYLRPDLKRG KITPNEENII LELHARWGNR WSTIARSLPG RTDNEIKNYW RTHFKKSAPN  120
SEKSKHLRRQ QYQYQQQQQQ QYQSAMNKIK YLLGVGDDTD NKASPLGHAG QETISVYPST  180
SEGQCLLSSV FNSFTSIADT SNEDIQWGGL WNIDDMNINF NTVSSTRREI QTHITPYC*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C1e-261611827128MYB TRANSFORMING PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010264825.11e-96PREDICTED: transcription factor MYB59-like
TrEMBLA0A061EPG82e-91A0A061EPG8_THECC; Myb domain protein 79 isoform 1
STRINGPOPTR_0010s07450.11e-88(Populus trichocarpa)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G13480.11e-68myb domain protein 79